TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q6UX65|DRAM2_HUMAN DNA damage-regulated autophagy modulator protein 2 OS=Homo sapiens OX=9606 GN=DRAM2 PE=1 SV=1
MWWFQQGLSFLPSALVIWTSAAFIFSYITAVTLHHIDPALPYISDTGTVAPEKCLFGAMLNIAAVLCIATIYVRYKQVHA
LSPEENVIIKLNKAGLVLGILSCLGLSIVANFQKTTLFAAHVSGAVLTFGMGSLYMFVQTILSYQMQPKIHGKQVFWIRL
LLVIWCGVSALSMLTCSSVLHSGNFGTDLEQKLHWNPEDKGYVLHMITTAAEWSMSFSFFGFFLTYIRDFQKISLRVEAN
LHGLTLYDTAPCPINNERTRLLSRDI