TCDB is operated by the Saier Lab Bioinformatics Group
>Q70J75|Q70J75_STRGR ATP-binding protein - Streptomyces griseus subsp. griseus.
MIEVHGLSRTFQAPQGEVNAVRGVDFTVAAGEIVGFLGPNGAGKTTTMRMLTTLLRPTSGTAVIAGHDLLGDPVGVRRRI
GYVAQGGGANPAESVVNELILQARLYGLSKSEARSRITALAGRLGLDGLEGRLVSSLSGGQRRRLDIALGLVHQPPLIFL
DEPSTGLDPTSRNNLWDHIRKLRDELGATVFLSTHYLDEADALCDRILIMDRGTILVEDSPEELKGRSRADTVTVEVAPE
GVAPATAVIERLPSARSVIPGGTTIRFRTEHSSRTMVDVMHALESSAVDIVSIQVDRPSLDDVFLALTGQPTEELHAAAT
APAGA