TCDB is operated by the Saier Lab Bioinformatics Group
>Q72H66|Q72H66_THET2 Maltose transport system permease protein malG - Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039).
MRRASRLLGRLFFYLLVVFVVVYSVFPFYWAVISSFKPSDALFSPDPSFLPVPFTLEHYENVFLQANFGRNLLNSLIVAG
GATLLSLVLGVLAAYALGRLPFPPKNAVMYIVLSMTMFPQIAVLGGLFLLLRQTGLFNTHLGLILTYLLFTLPFTVWVLV
GYFRGLPRELEEAAYVDGATPLQTLLKVMLPLTGPGLVTTGLLAFIAAWNEYLFALTFTVGDSVKTVPPAIASFGGATPF
EIPWGSIMAASVVVTVPLVVLVLVFQQRIVAGLTAGAVKG