TCDB is operated by the Saier Lab Bioinformatics Group
>Q72H68|Q72H68_THET2 Trehalose/maltose-binding protein - Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039).
MQRRTFLKKLGVGVAASLVLGPALVRAQSGPVIRVAGDSTAVGEGGRWMKEMVEAWGKKTGTRVEYIDSPADTNDRLALY
QQYWAARSPDVDVYMIDVIWPGIVAPHALDLKPYLTEAELKEFFPRIVQNNTIRGKLTSLPFFTDAGILYYRKDLLEKYG
YTSPPRTWNELEQMAERVMEGERRAGNRDFWGFVFQGKPYEGLTCDALEWIYSHGGGRIVEPDGTISVNNGRAALALNRA
HGWVGRIAPQGVTSYAEEEARNVWQQGNSLFMRNWPYAYALGQAEGSPIRGKFGVTVLPKASADAPNAATLGGWQLMVSA
YSRYPKEAVDLVKYLASYEVQKDNAVRLSRLPTRPALYTDRDVLARNPWFRDLLPVFQNAVSRPSDVAGARYNQVSEAIW
TEVHSVLTGRKKGEQAVRDLEARIRRILR