TCDB is operated by the Saier Lab Bioinformatics Group
>Q72KX2|Q72KX2_THET2 Glucose-binding protein - Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039).
MRKWLLAIGMVLGLSALAQGGKLEIFSWWAGDEGPALEALIRLYKQKYPGVEVINATVTGGAGVNARAVLKTRMLGGDPP
DTFQVHAGMELIGTWVVANRMEDLSALFRQEGWLQAFPKGLIDLISYKGGIWSVPVNIHRSNVMWYLPAKLKEWGVNPPR
TWDEFLATCQTLKQKGLEAPLALGENWTQQHLWESVALAVLGPDDWNNLWNGKLKFTDPKAVRAWEVFGRVLDCANKDAA
GLSWQQAVDRVVQGKAAFNVMGDWAAGYMTTTLKLKPGTDFAWAPSPGTQGVFMMLSDSFGLPKGAKNRQNAINWLRLVG
SKEGQDTFNPLKGSIAARLDSDPSKYNAYGQSAMRDWRSNRIVGSLVHGAVAPESFMSQFGTVMEIFLQTRNPQAAANAA
QAIADQVGLGRLGQ