TCDB is operated by the Saier Lab Bioinformatics Group
>Q72KX4|Q72KX4_THET2 Sugar transport system permease protein - Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039).
MGRALLYGFLLLMAGFFLLPVYLVVLTALKEPARITLETVWQWPHPPYWESFRTAWEAFRPKFQNSVVLAVSATLLSALV
GSLNGYVLAKWPFRGSGLLFALILFGMFIPYQSILIPLFQFMKSIGLYGSLFGLVLVHVIYGIPIVTLIFRNYYSEIPDE
LVEAARIDGAGFFGIFRHVILPLSVPAFVVVAIWQFTQIWNEFLFAVTLTRPESQPITVALAQLAGGEAVKWNLPMAGAI
LAALPTLLVYILLGRYFLRGLLAGSVKG