TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q7A676|Q7A676_STAAN PotD protein OS=Staphylococcus aureus (strain N315) GN=potD PE=4 SV=1
MKRFLQLIIGALVVGMLCLTLSHWFKSKEQVHTNQKIYVYNWGEYIDPELIKKFEKETGIQVVYETFDSNEAMEAKIRNG
GTHYDVAFPSEYTVQKLKRDHLLLPIDHNKVPNIKNLDSDYMNMSFDKGNKYSLPYFFGTVGILYNKEKYPNESFDSWKS
LYNPKFKNQILLVDGAREIIGMSLNKLGYNLNDRNSHHLKEAERDLTKLAPQVRGVVGDEITMMLQQNEGNIAVVWSGVA
APLVQEGDKYNYVIPKEGSNLWFDNMVIPKTAQNKEGAYKFMNFLLDAKNNKQNTEFVGYATPNKAARQLLPKEIKDDHR
FYPTKKEQERLEVYKDLGPEVLSEYNENFLNFKMSLK