TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q7A677|Q7A677_STAAN PotC protein OS=Staphylococcus aureus (strain N315) GN=potC PE=3 SV=1
MKWYGKLYIGILLAILYIPIFFLMFYSFNSAGNMIHFEHFTLEHYQSLFQNDHLMSVIFNTIAVALLAASISTVIGTFGA
IAIYYLRNKKFKVTLLTLNNVLMVSSDVVIGASFLIMFTTIGHFTGLGLGFWTVLISHIAFCIPIVVIIVLPQLYEMNNN
MLNAARDLGATEPQLLSNIIIPNILPSIIGGFFMALTYSLDDFTVSFFVTGNGFSVLSVEVYAMARKGISMEINAISTLL
FAVIVLGILGYYLIQYVINKKKLIKRGVK