TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q83N16 Multidrug efflux protein - Tropheryma whipplei.
MVFIPSVLSSMVEGGLLPSVALIAAHESSSSALAGLAVSAGLIGYLASNIPGGIVVSRFGELRGMMIALSCAGISVLINI
FSSSVALLTFGVFLSGFSFGAYGVARHSFMTLYTPLKVRARAFSVLGGAFRLGGALGTFLVSGVVVLTGNVRSVFVVHLA
IVILLVIFLFLVRNVQKTDKSPKMLAEQPNSIKAMWEAVQSKKGQLITIGSAAGILAAARVSRSVILPLVGLHVGLKPEQ
ITFIIGIGSTLEAFLFYSSGYVMDKWGRVWSAAPALFMVGGAYLLVFFAESYVAFLAISLLMGIGNALGSGIILTLGADL
AGTSDQTAFISVWRLVTDIGQSVGPLGMSTLLGITSLTGAAGVMGLTCFAAAGIMIRYLHIYLPNKRAKT