TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q88NY3|Q88NY3_PSEPK Amino acid ABC transporter, permease protein OS=Pseudomonas putida (strain KT2440) GN=PP1070 PE=3 SV=1
MNYNWDWGVFFKSTGVGSETYLDWYITGLGWTIAIAITAWIIALLLGSLLGVMRTVPNRLVSGIATAYVELFRNVPLLVQ
LFIWYFLVPDLLPEGLQEWFKQDLNPTTSALISVVICLGLFTAARVCEQVRTGIQALPKGQEAAARAMGFSLPQIYNNVL
LPQAYRIIIPPLTSEFLNVFKNSSVASLIGLMELLAQTKQTAEFSANLFEAFTLATLIYFTLNMGLMLLMRMVEKKVAVP
GLISVGGK