TCDB is operated by the Saier Lab Bioinformatics Group
>Q8DU37|Q8DU37_STRMU Putative sugar ABC transporter, ATP-binding protein - Streptococcus mutans.
MAQHVIEMREITKKFDDFVANDHINLDLRKGEIHALLGENGAGKSTLMNMLAGLLEPTSGSIKINGSAVTIDSPSKSAQL
GIGMVHQHFMLVEAFTVTENIILGNEVVKNGILDLKKAGQEIKALSEKYGLAVDPNAKIADISVGAQQRVEILKTLYRGA
DILIFDEPTAVLTPSEIQELMTIMKSLVKEGKSIILITHKLDEIRSVADRVTVIRRGKSIETVEVSGTTSQDLAEMMVGR
SVSFTIEKTPTKPKETILSIKDLVVNENRGIPAIKGLSLEVKAGEIIGIAGIDGNGQSELVQAITGLRKIKSGHLTIKGQ
DVTKLSTRKITELSVGHVPEDRHRDGLILELTMAENLALQTYYKAPLSHNGVLNYSKINEHGRHLMQEFDVRGANELIPA
KGFSGGNQQKAIIAREVDRDPDLLIVSQPTRGLDVGAIEYIHKRLIAERDEGKAVLLVSFELDEILNLSDRIAVIHDGQI
QGIVTPETTNKQELGILMAGGSIEREEINV