TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8G845|Q8G845_BIFLO Probable ABC transporter permease protein for sugars OS=Bifidobacterium longum (strain NCC 2705) GN=BL0036 PE=4 SV=1
MTTATANKVKAPKKGFKLDRQMIPTLAAVVIFILMIIMGQALFGTYIRLGFISSLFIDHAYLIILAVAMTLPILTGGIDL
SVGAIVAITAVVGLKLANAGVPAFLVMIIMLLIGAVFGLLAGTLIEEFNMQPFIATLSTMFLARGLASIISTDSLTFPQG
NDFSFISNVIKIIDNPKISNDLSFNVGVIIALVVVVFGYVFLHHTRTGRTIYAIGGSRSSAELMGLPVKRTQYIIYLTSA
TLAALASIVYTANIGSAKNTVGVGWELDAVASVVIGGTIITGGFGYVLGSVLGSLVRSILDPLTSDFGVPAEWTTIVIGL
MILVFVVLQRAVMAVGGDKK