TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8G846|Q8G846_BIFLO Probable ABC transport system permease protein for sugars OS=Bifidobacterium longum (strain NCC 2705) GN=BL0035 PE=4 SV=1
MAEKAKAEGNNFVKKLLSSNLTWSIVAFILLVIICTIFQHDFLALSWNSNTGGLAGPLITMLQESARYLMIATGMTLVIS
TAGIDLSVGSVMAVAGAAAMQTLSNGMNVWLSILIALAVGLAIGCVNGALVSFLGLQPFITTLIMMLAGRGMAKVITSGE
NTDASAVAGNEPLKWFANGFILGIPANFVIAVIIVILVGLLCRKTAMGMMIEAVGINQEASRMTGIKPKKILFLVYAISG
FLAAIAGLFATASVMRVDVVKTGQDLEMYAILAVVIGGTSLLGGKFSLAGSAVGAVIIAMIRKTIITLGVNAEATPAFFA
VVVIVICVMQAPKIHNLSANMKRKRALKAQAKAVAA