TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8G848|Q8G848_BIFLO Probable solute binding protein of ABC transporter system possibly for sugars OS=Bifidobacterium longum (strain NCC 2705) GN=BL0033 PE=4 SV=1
MKNWKKAIALVASAAALVSVAACGSSNAGGSSDSGKKTVGFVAVGPEGGFRTANEKDIQKAFEDAGFDLTYSPTQNNDQQ
KQIQAFNKFVNDEVDAIILSSTEDSGWDDSLKKAAEAEIPVFTVDRNVDVKDAEAKKAIVAHIGPSNVWCGEQAAEFVNK
NFPDGANGFILEGPAGLSVVKDRGTGWGNKVASNVKVLESQSANWSTDEAKTVTAGLLDKYKSDNPQFIFAQNDEMGLGA
AQAVDAAGLKGKVKIITIDGTKNALQALVDGDLSYVIEYNPIFGKETAQAVKDYLDGKTVEKDIEIESKTFDAASAKEAL
DNNTRAY