TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8KN19|Q8KN19_9ACTO Putative sugar transporter sugar-binding protein OS=Streptomyces sp. 139 GN=ste2 PE=4 SV=1
MGAQGIPEEGWRVKRKLIAAIGVAGMLFSVAACGGDDGDGGKKAGVDGYAGQTLTVWVMDGSSPDQWQKDLTAEFEKKTK
AKVKFEVQQWNGIQQKLTTALSEENPPDVFEIGNTQTPAYAKTGGLADLADLKSEIGGEWTESLNESSVFEGKQYAAPWY
FANRVVLYNKKVWADAGLKDTPKTRDEFYAALKTIGAKTDAEPIYLPGQNWYHFVGLVVGEGGELVKKDGDKYVSNLDDP
KVAKAAETYKKFQALSKAPKDKDEATPQQGEVFAKGNVGAFIGMGWEAGIAIEANPAIEKEIGYFTIPGATADKPEGVFL
GGSNLAVAAGSQKQELAKEFLKLALSDKYEGQLAKLNGVIPNKESLQGNLKGNAPAEAAAPAAAVGGTTPLIPEWAAVEN
DPNPVKTYLTAVLNGKSPAAAAKQVEGEFNKRLAQQQ