TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q8SQU5|YBD4_ENCCU ABC transporter-like protein ECU11_1340 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU11_1340 PE=1 SV=1
MKQHTLQLEGVTLDVPNQNLSSNEKYARLINGLTADFKSGNVYAFMGTSGSGKTTTLETIAGLVPSGSRTGGRILVDGQE
RNPDEFPYEFAYGDQLGYIIDELTVEEFVYYYVVSSLPEESKERVREKMDEVLENLLNIGHIRHNKMKNISGGEQKRANL
ARTFTKMLLLEGELKVVLLDEPTSELDAGLALKLGEFLRDYARRSNSIVLVTVHQPGAELYNTFDNLLFMNNGEKLYLGP
SRDFIKFLGTKGIHNDGGPETNMEFLFSLFTKGSKMSKKYEKQLEQIAKEMNEEKKEEKKLRTSDDTEINFIPNLYVSFQ
MAIRQIIIDWRNREILYSLAMPIAMALFLVTGKYIYKDFSIATIKASMLSLSLYYVMNPSGLMNDKHYVTEESNRKLYGA
AEVWFSSLISDTLVSILKYCIFFGIIYAFGLISMDHAFLGQVLMYTLGGTVSSMLFRSMASPLSTLGKVFNTTMVLMFQL
SGALLGAGALLGALTLWISVIPEGSIPQEEIDAFISNFFDSTGSTGSTSIFSKVGSWVIRFICLVPKVVRSFLRILFLMF
HPFAFFHSSILDAEKSSYKLFF