TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q8VEM8|MPCP_MOUSE Phosphate carrier protein, mitochondrial OS=Mus musculus GN=Slc25a3 PE=1 SV=1
MFSSVAHLARANPFNAPHLQLVHDGLSGPRSPPAPPRRSRHLAAAAVEEYSCEFGSMKYYALCGFGGVLSCGLTHTAVVP
LDLVKCRMQVDPQKYKGIFNGFSITLKEDGVRGLAKGWAPTLIGYSMQGLCKFGFYEVFKALYSNILGEENTYLWRTSLY
LASSASAEFFADIALAPMEAAKVRIQTQPGYANTLREAVPKMYKEEGLNAFYKGVAPLWMRQIPYTMMKFACFERTVEAL
YKFVVPKPRSECTKAEQLVVTFVAGYIAGVFCAIVSHPADSVVSVLNKEKGSTASQVLQRLGFRGVWKGLFARIIMIGTL
TALQWFIYDSVKVYFRLPRPPPPEMPESLKKKLGLTE