TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8Y992|Q8Y992_LISMO Lmo0641 protein OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo0641 PE=3 SV=1
MKDWMKQNWQFITTGISGILIVIGCLVGSDVGDFWTAIIFLSAFVIGGFEQAKEGIQATIKTKKLNVELLMILAATGASI
IGYWFEGAILIFIFSVSGALETYTTNKSKREITKLMAFQPERAFRLLSNGDLEEVAAKELQLDDMVFVRPGESVPIDGVI
VRGSTTLNEAAINGESVPATKTVGADVFGGTVNVSSAITVKVTQTFENTIFSKIIRLVETAQSEPSKTARFIERFEDVYV
KAVLLFVLVMMFLPHFALGWSWNETFYRAMVLLTVASPCALVASVTPATLAAISNGARHGILFKGGVHLENLRGVKAIAF
DKTGTLTNGTPALTDRLFAENVDKQLVINVVGAMERQSLHPLAAAITQDLEPEITEKLTEIEVTDVPGWGVQAIYREGNW
QVGKAGFVGKEAAAAFSNGAFERLASEGKTIVYVAKDGVIQAMFALKDTCRPEAIRTIKALQAKGIKTIMVTGDNEQTGA
AIQAELGMDYVVSGCLPEKKVDVLRELSVTYGSVAMVGDGINDAPALAHAAVGIAMGEGTDIAMETADVVLMKNDLEKIP
YAYTLSERLHWITWQNICFAIAVILVLITANVFQLINLPFGVVGHEGSTILVILNGLRLLRSNRKK