TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q96DZ9|CKLF5_HUMAN CKLF-like MARVEL transmembrane domain-containing protein 5 OS=Homo sapiens OX=9606 GN=CMTM5 PE=1 SV=2
MLSARDRRDRHPEEGVVAELQGFAVDKAFLTSHKGILLETELALTLIIFICFTASISAYMAAALLEFFITLAFLFLYATQ
YYQRFDRINWPCLLQGHGQSGGPHPLDLLSHSAKVQPQPWPGLTPPGWHTPAAVPWVPAPAPGFWSWLLWFICFHSLGSS
DFLRCVSAIIIFLVVSFAAVTSRDGAAIAAFVFGIILVSIFAYDAFKIYRTEMAPGASQGDQQ