TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q99653|CHP1_HUMAN Calcineurin B homologous protein 1 OS=Homo sapiens GN=CHP1 PE=1 SV=3
MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNF
RGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDEKISRDELLQVLRMMVGVNISDEQLGSIADRTI
QEADQDGDSAISFTEFVKVLEKVDVEQKMSIRFLH