TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q9BQJ4|TMM47_HUMAN Transmembrane protein 47 OS=Homo sapiens OX=9606 GN=TMEM47 PE=1 SV=1
MASAGSGMEEVRVSVLTPLKLVGLVCIFLALCLDLGAVLSPAWVTADHQYYLSLWESCRKPASLDIWHCESTLSSDWQIA
TLALLLGGAAIILIAFLVGLISICVGSRRRFYRPVAVMLFAAVVLQVCSLVLYPIKFIETVSLKIYHEFNWGYGLAWGAT
IFSFGGAILYCLNPKNYEDYY