TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q9BUR5|MIC26_HUMAN MICOS complex subunit MIC26 OS=Homo sapiens OX=9606 GN=APOO PE=1 SV=1
MFKVIQRSVGPASLSLLTFKVYAAPKKDSPPKNSVKVDELSLYSVPEGQSKYVEEARSQLEESISQLRHYCEPYTTWCQE
TYSQTKPKMQSLVQWGLDSYDYLQNAPPGFFPRLGVIGFAGLIGLLLARGSKIKKLVYPPGFMGLAASLYYPQQAIVFAQ
VSGERLYDWGLRGYIVIEDLWKENFQKPGNVKNSPGTK