TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q9C8G9|MRP1_ARATH Multidrug resistance-associated protein 1 OS=Arabidopsis thaliana GN=MRP1 PE=1 SV=1
MGFEPLDWYCKPVPNGVWTKTVDYAFGAYTPCAIDSFVLGISHLVLLILCLYRLWLITKDHKVDKFCLRSKWFSYFLALL
AAYATAEPLFRLVMRISVLDLDGAGFPPYEAFMLVLEAFAWGSALVMTVVETKTYIHELRWYVRFAVIYALVGDMVLLNL
VLSVKEYYGSFKLYLYISEVAVQVAFGTLLFVYFPNLDPYPGYTPVGTENSEDYEYEELPGGENICPERHANLFDSIFFS
WLNPLMTLGSKRPLTEKDVWHLDTWDKTETLMRSFQKSWDKELEKPKPWLLRALNNSLGGRFWWGGFWKIGNDCSQFVGP
LLLNELLKSMQLNEPAWIGYIYAISIFVGVVLGVLCEAQYFQNVMRVGYRLRSALIAAVFRKSLRLTNEGRKKFQTGKIT
NLMTTDAESLQQICQSLHTMWSAPFRIIVALVLLYQQLGVASIIGALFLVLMFPIQTVIISKTQKLTKEGLQRTDKRIGL
MNEVLAAMDTVKCYAWENSFQSKVQTVRDDELSWFRKAQLLSAFNMFILNSIPVLVTVVSFGVFSLLGGDLTPARAFTSL
SLFSVLRFPLFMLPNIITQMVNANVSLNRLEEVLSTEERVLLPNPPIEPGQPAISIRNGYFSWDSKADRPTLSNINLDIP
LGSLVAVVGSTGEGKTSLISAMLGELPARSDATVTLRGSVAYVPQVSWIFNATVRDNILFGAPFDQEKYERVIDVTALQH
DLELLPGGDLTEIGERGVNISGGQKQRVSMARAVYSNSDVCILDDPLSALDAHVGQQVFEKCIKRELGQTTRVLVTNQLH
FLSQVDKILLVHEGTVKEEGTYEELCHSGPLFQRLMENAGKVEDYSEENGEAEVDQTSVKPVENGNANNLQKDGIETKNS
KEGNSVLVKREERETGVVSWKVLERYQNALGGAWVVMMLVICYVLTQVFRVSSSTWLSEWTDSGTPKTHGPLFYNIVYAL
LSFGQVSVTLINSYWLIMSSLYAAKKMHDAMLGSILRAPMVFFQTNPLGRIINRFAKDMGDIDRTVAVFVNMFMGSIAQL
LSTVILIGIVSTLSLWAIMPLLVVFYGAYLYYQNTSREIKRMDSTTRSPVYAQFGEALNGLSSIRAYKAYDRMAEINGRS
MDNNIRFTLVNMAANRWLGIRLEVLGGLMVWLTASLAVMQNGKAANQQAYASTMGLLLSYALSITSSLTAVLRLASLAEN
SLNSVERVGNYIEIPSEAPLVIENNRPPPGWPSSGSIKFEDVVLRYRPELPPVLHGVSFLISPMDKVGIVGRTGAGKSSL
LNALFRIVELEKGRILIDECDIGRFGLMDLRKVLGIIPQAPVLFSGTVRFNLDPFSEHNDADLWESLERAHLKDTIRRNP
LGLDAEVTEAGENFSVGQRQLLSLARALLRRSKILVLDEATAAVDVRTDVLIQKTIREEFKSCTMLIIAHRLNTIIDCDK
VLVLDSGKVQEFSSPENLLSNGESSFSKMVQSTGTANAEYLRSITLENKRTREANGDDSQPLEGQRKWQASSRWAAAAQF
ALAVSLTSSHNDLQSLEIEDDNSILKKTKDAVVTLRSVLEGKHDKEIEDSLNQSDISRERWWPSLYKMVEGLAVMSRLAR
NRMQHPDYNLEGKSFDWDNVEM