TCDB is operated by the Saier Lab Bioinformatics Group
>Q9C8T1|NAP10_ARATH Putative non-intrinsic ABC protein 10 - Arabidopsis thaliana (Mouse-ear cress).
MSIRRPQIPRLLLQNVSCMRNAQQILRHVNVSLHDGGALVLTGTNGSGKSTFLRMLAGFSKPSAGEILWNGHDITQSGIF
QQYKLQLNWISLKDAIKERFTVLDNVQWFELLENKIGKAQPALELMGLGRLVKEKSRMLSMGQRKRLQLARLLAIDRPIW
LLDEPSVALDDEGVRLLEYIIAEHRKKGGIVIVATHLPIDIEDAMILRLPPRFPRKMTLIDMLDRADIS