TCDB is operated by the Saier Lab Bioinformatics Group
>Q9H0Q3|FXYD6_HUMAN FXYD domain-containing ion transport regulator 6 - Homo sapiens (Human).
MELVLVFLCSLLAPMVLASAAEKEKEMDPFHYDYQTLRIGGLVFAVVLFSVGILLILSRRCKCSFNQKPRAPGDEEAQVE
NLITANATEPQKAEN