TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q9H6X4|TM134_HUMAN Transmembrane protein 134 OS=Homo sapiens GN=TMEM134 PE=1 SV=1
MSAARPQFSIDDAFELSLEDGGPGPESSGVARFGPLHFERRARFEVADEDKQSRLRYQNLENDEDGAQASPEPDGGVGTR
DSSRTSIRSSQWSFSTISSSTQRSYNTCCSWTQHPLIQKNRRVVLASFLLLLLGLVLILVGVGLEATPSPGVSSAIFFVP
GFLLLVPGVYHVIFIYCAVKGHRGFQFFYLPYFEK