TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q9HBW0|LPAR2_HUMAN Lysophosphatidic acid receptor 2 OS=Homo sapiens GN=LPAR2 PE=1 SV=2
MVIMGQCYYNETIGFFYNNSGKELSSHWRPKDVVVVALGLTVSVLVLLTNLLVIAAIASNRRFHQPIYYLLGNLAAADLF
AGVAYLFLMFHTGPRTARLSLEGWFLRQGLLDTSLTASVATLLAIAVERHRSVMAVQLHSRLPRGRVVMLIVGVWVAALG
LGLLPAHSWHCLCALDRCSRMAPLLSRSYLAVWALSSLLVFLLMVAVYTRIFFYVRRRVQRMAEHVSCHPRYRETTLSLV
KTVVIILGAFVVCWTPGQVVLLLDGLGCESCNVLAVEKYFLLLAEANSLVNAAVYSCRDAEMRRTFRRLLCCACLRQSTR
ESVHYTSSAQGGASTRIMLPENGHPLMDSTL