TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9HU29|Q9HU29_PSEAE Amino acid (Lysine/arginine/ornithine/histidine/octopine) ABC transporter membrane protein OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA5155 PE=3 SV=1
MSEWELILKWMPKMLQGAALTLELLAIAVVAGLALALPLGIARASRHWYVRAVPYAYIFFFRGTPLLLQLFIVYYGLAQF
EEVRKSAFWPYLRDPYWCALLTMTLHTAAYIAEILRGAIHSVPVGEVEAARALGMSRRQALWHIILPRAVRIGLPAYSNE
VILMLKASAVVYTVTLFDIMGMARTIIARTYESMLFFCLAGALYLVITIVLTRIFRLIERWLRVDATQGR