TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9KZE5|Q9KZE5_STRCO Putative ABC-transport protein OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=ecaA PE=4 SV=1
METTAWTQLYSVMNAKDERRPFARATMRRIGAFARPHRRRIVRFVLLGVATALLAVATPVLAGKVVDAIVSDGDEGTVVR
LALLIALIAVAEAVLGIFSRRLSATLGEGLILDLRTAVFDHVQRMPVAFFTRTRTGALVSRLNNDVIGAQRAFSNTLSGV
VSNVVTLLLTLAVMLTLSWQITLLALVLLPVFVLPARRMGRRMARMQREAAALNAAMGTRMTERFSAPGATLIKLFGRPE
EESAEFADRARRVADIGVRTATAQAAFITALTLVSALALALVYGLGGFFALRGTLDAGAVVALALLLTRLYAPLTALAGA
RVEVMSALVSFERVFEVLDLAPLIDEKPDARPVPDGPVAVEFDDVRFGYPSADKVSLASLEEVATLDTRGGEEVLHGLSF
RAEPGQTIALVGSSGAGKSTIAQLLPRLYDTDGGTVRVGGVDVRELSARSLRDTVGMVTQDGHLFHDTVRANLLLARPDA
TEDDLWEALRRARLADLVRSLPDGLDTVVGERGYRLSGGERQRMTIARLLLARQRVVILDEATAHLDNTSEAAVQEALTE
ALQGRTAVVIAHRLSTVRAADRILVVEAGRIVESGTHEELLAVDGRYAQLHRTQFERPALDKAA