TCDB is operated by the Saier Lab Bioinformatics Group
>Q9LZI6|Q9LZI6_ARATH Putative uncharacterized protein F26K9_220 - Arabidopsis thaliana (Mouse-ear cress).
MASGWGITGNKGRCYDFWMDFSECMSHCREPKDCTLLREDYLECLHHSKEFQRRNRIYKEEQRKLRAASRKGEETGDGTH
THH