TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9R9Q6 ThuF (Probable trehalosemaltose transporter permease protein) - Rhizobium meliloti (Sinorhizobium meliloti).
MTDLSLADRPAALAHGGRIGSDLQAQRVRSAWLFLAPTFLVLALVAGWPLIRTIYFSFTNASLTNLSGAEFVGFANYLSW
ITLKSGRTIYRGLLADPAWWNAVWNTLKFTVLSVSIETALGLIVALVLNAQFPGRGLVRAAILIPWAIPTIVSAKMWAWM
LNDQFGILNDMLIGLGLIGEKIAWTASPDTAMIAELIVDVWKTTPFMALLILAGLQMVPGDIYEAAKIDGVHPVRVFWRV
TLPLIRPALMVAVIFRMLDALRIFDLIYVLTPNNAQTKTMSVMARENLFDFDKFAYGAAASTMLFLIIATITILYMWLGR
LNLSGGER