TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9R9Q7 ThuE (Probable trehalosemaltose-binding protein) - Rhizobium meliloti (Sinorhizobium meliloti).
MNVKPFVRTLISCAAIAGAIDLAAAAELSMAANSTGKNLSFLRDQIARFEKETGHKVNLVTMPASSSEQFSQYRLWLAAG
NKDVDVYQTDVIWAPQLAEQFVDLTEATKDVVGEHFPSIIQSQTVNGKLVALPFYTDAPALYYRKDLLDKYGKTPPKTWD
ELAATAKEVQDKERAAGSADIWGFVFQGNAYEGLTCNALEWIKSSGGGQIIEPDGTISVNNEKAAAAVEKVKEWIGTIAP
KGVLAYQEEESRGVWQTGNAVFMRNWPYAYALGNGDDSAVKGKFEVAPLPAATDGDQPSSTLGGWNLAVSKYSDEQEAAI
AFVKFLGSAETQKVRAIELSNLPTIAALYDDPEVAAAQPFMPHWKPIFQSAVPRPSAVAKVKYNEVSSKFWSAVHNTLSG
NGTAAENLELLEVELTELKGDAW