TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9S243|Q9S243_STRCO Putative integral membrane transport protein OS=Streptomyces coelicolor GN=SCO1709 PE=4 SV=1
MVPSGNRGWLLRLVIAFGFAQAAVSMARPAVSYRALALGADERAVGVIAGVYALLPLFAAVPLGRRTDHGRCAPLLPAGV
VLIAGGCALSGVAGSLSTMALWSGVMGLGHLCFVIGAQSLVARQSAPHEQDRNFGHFTIGASLGQLIGPIAAGALIGGPD
MAGSSALALVVAGAGAAVAFTSLWRTEHPGAAKSRAQQGARVPVVSILRARGVPAGILISLSVLSATDILTAYLPVVGEQ
RGISPAVIGVLLSLRAAATIACRLVLTPLLRLLGRTVLLTVTCLLAALLCAGVALPVPVWALALMLVVLGFCLGVGQPLS
MTTVVQAAPDEARSTALALRLTGNRLGQVAAPAAAGLIAGVAGVAAPFVMLGALLLLSSGVALRSPSTGTTGTTGAGGAG
GAGGAGGTTGTAGASGASGASGASGASGASGATGRAAGPRSPEIGQDVPDRAGDSRPCRESRG