TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9VS47|Q9VS47_DROME CG8602, isoform B OS=Drosophila melanogaster GN=CG8602 PE=2 SV=1
MAREDEERIVDNEEVSRPTEEDQVVSRAGRRDNELSLPSGGCCMPSSTSHRFMALVFMCLLGFGSYFCYDAPGALQNYFK
KDLNLTSAQFTLIYSIYSWPNVVLCFVGGFLIDRLFGIRLGTIIYMMILLVGQLIFACGGILDAFWMMILGRFIFGIGAE
SLAVAQNSYAVLWFKGKELNMVFGLQLSVARFGSTVNFWVMQPIYEYVSNFYKGHTALGVVLLLATLTCVMSMTCALILG
WMDKRAERILQRNNNPAGQIPKLTDVFSFKPPFWMVSIICVAYYVAIFPFIALGQNFFVDRFGLSPAEANTVDSLVYLIA
AVSSPVFGFIIDKLGRNVTWVFTATLTTIGAHALLTFTQLTPYVGMIIMGLSYSMLAASLWPLVALIIPEYQLGTAYGFC
QSIQNLGLAVITIVAGIIVDHSGGEHMWLQLFFMGWLTIALISTGVIWAYNNKNRGNLNMTPQQRAQFVSAENYQNFE