TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9XCS2 SitA (Salmonella iron transporter: fur regulated) (Iron transport protein, periplasmic-binding protein) - Salmonella typhimurium, and Salmonella typhi.
MTNLHRLKTLLIAGIVAILALSPAYAKEKFKVITTFTVIADMAKNVAGDAAEVSSITKPGAEIHEYQPTPGDIKRAQGAQ
LILANGLNLERWFARFYQHLSGVPEVVVSTGVKPMGITEGPYNGKPNPHAWMSAENALIYVDNIRDALVKYDPDNAQIYK
QNAERYKAKIRQMADPLRAELEKIPADQRWLVTSEGAFSYLARDNDMKELYLWPINADQQGTPKQVRKVIDTIKKHHIPA
IFSESTVSDKPARQVARESGAHYGGVLYVDSLSAADGPVPTYLDLLRVTTETIVNGINDGLRSQQ