TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q9Z3R5|AGLE_RHIME Alpha-glucosides-binding periplasmic protein aglE precursor - Rhizobium meliloti (Sinorhizobium meliloti).
MKRSLLIGVAAFALLAGTAGLAGTAGAADLKFKPGEDSRFNWASLEEFKKGHDLKGQTLTIFGPWRGEDEALFKSVYAYF
VEATGVELKYSSSENYEQQIVIDTQAGSPPDVAILPQPGLIADLAAKGLLTPLGDETKQWLLDNYAAGQSWVDLSTYNGK
DGTSALYAFPYKIDVKSLVWYVPENFEDAGYEVPKTMEELKALTEKIAEDGEKPWCIGLGSGGATGWPATDWVEDLMLRT
QPAETYDKWVKNEIPFTDAAVTGALEEFGWFARNDAFVDGGAAAVASTDFRDSPKGLFSSPPKCYLHHQASFIPSFFPEG
KVVGEDADFFYMPPYESKKELGNPVLGAGTLAMITKDTPAARAFIEFLKTPIAHEVWMAQTSFLTPYKSVNVDVYGNPPL
KKQGEILLNATTFRFDGSDLMPGKIGAGAFWTGMVDFVGGKSSADVAAGVQKAWDSIK