TCDB is operated by the Saier Lab Bioinformatics Group
>RQM16006.1 hypothetical protein DD237_004461 [Peronospora effusa]
MSDKNDLLNIPETHIKLVDPNEDTYFGRVHKTFYILDFRTAFTTEKALQDAKQHVSMHRRGEFVDPMKLEHAKYVTNAIL
HPDTGLPVFTPLRASMIVPMNMIMDGAMLLTNSTRTTIFAQWLNQTYNALHYYANRNASNEDTAQQRLVAYVGATASSVG
ASLGIRRLVGRMKGGKWAPAVARMGPFAAVAAADLINMAVMRQSEYRNGVHVYDENGDHVGKSKRCGALAVASCVTGRIF
AAAPILLLPPLVISGIEKHSMLFTRPTTRWLRVPTLLGLVGCAIQFSVPLTFGLFRQTAQLDSKYLESGLQQATRKQDGQ
PVRVVTYNKGI