TCDB is operated by the Saier Lab Bioinformatics Group
>SIM59375.1 integral membrane protein [Mycobacteroides abscessus subsp. abscessus]
MAARLSTGTLKRQAGRILRFSIVLPLFMTVMFPLIYGFSMHAPTPHHLKVAVVAQDASAEHLVDRLDAAAGDSYDVSAVD
SAEEAKRQIEALQVRAAWDPQTNTEYVASMGSTSATQFAESYIAKIAPKVLVELGKAESAEQAPAPTVQDLVPPPGGDGL
GLSLLFMGLPVMMAGFMTATGLRSNLAQLSARVAISIMAVLALAYATLATFVGYSVYAAFQVHALPIFLLMAFASFIVML
FHTGGMRVIGLYMALPTIFLLVLLGVPSSGAGMATELVPPVVAALHPWLPTPALLDALRKLLYFPTASLAGNVITLLLWF
FLALALLGASFLRRPRPTDADAVPAEKDEQEAVADTPGTRAEGRAREQLRAAVASTRGFRGFFGSRRVVSDEQMQNRRGL
HAAIRLPMFFAIAMPLMYLGLVHHPAPNGMVLDVVADGAQGTSIAKTLEQLPAYEVHRVDSAEQARQDMLHGRARGAFVP
AADAAEVPGAEAGKGPVVLVASGTGIQAESAVTTVFAAVSGEVSPQTVDLAPTHANDRFGMSMMYLGLGGIVGSNIAGMM
IGLVGRGWSWYRRLAWVLGVAAANTGLQYLISVHVVRFLPADVDWTVWPILFLMSVSIQIFAVGGALLIRNDVMIWLIGV
FIMCGVPASGLLLPLDMAPDRYQILHHLVPSAVALGAIRSRVYLPEAPVGSAVLTELIWLAAALLVYLWGCLHVRRLRRR
DEAAAAREAHQFDDAEAGEFEGAVLSGSPGPQTRQLQVVRAAAKEAARSRS