TCDB is operated by the Saier Lab Bioinformatics Group
>tr|W1HZL5|W1HZL5_KLEPN Probable integral membrane protein NMA1777 OS=Klebsiella pneumoniae IS39 PE=4 SV=1
MAPGVAISLKRLAWRHRKKLCITFMLVIAENVAFLLYPVLAGMAINAILGGQTSHAALYGLMVLFMWCMGAARRSVDTRT
FARIYASLAVTVVLSQRKYSLNHSTIAARVTLSREFVDFFELHLPVLITSIISLFGAAIMLLWIEFWTGIACLIIVAILM
CFVSSYASKNETFYRRLNNRLEKEVDYVNKASFGALKRHYDTLARLRVVLSDREAWGYLSIGLLVSALFSMTIIRMSMES
GINAGHIYSVMTYMWMFATSLDDAPQLLEKFSQLRDIGKRVSTDDETSLSGKPC