TCDB is operated by the Saier Lab Bioinformatics Group
>tr|W9E550|W9E550_RHILI Arabinose efflux permease family protein OS=Mesorhizobium loti R7A GN=MesloDRAFT_0420 PE=4 SV=1
MAATAVTIHSDKDTAEPIFTASMLGMAGVMFSAMSSFYLLLSAIAAHAASLGGAGAAGHATGALMAATIGGEIAAPRIIA
ACGRKVSLVLALGLLGTACLMAFPSSLSLLLLNCLVRGVALGVLLVTASGISAKLAPPSRRAEAMSLYGVASAVPAILAV
PLGPWVLSHLGPSVTALGGCGLAVIALGATAILPVDISRDDDCDHRMPPWSLVAIPATALACGAILVGAAVTILPLAHPE
ASSGEIMLGLLFQGAGAAFTRWASARQVDRHGPKVPTGAGLASCALAAVCLALPSQAAMLTGMLLSGMAFGVLQSATVAD
VLSRVAPSQGDGAGALWNVAYDAGLGIGGLAVAALATSVGFGAAFAATAALFALVMLFALKPDGTSRRPN