TCDB is operated by the Saier Lab Bioinformatics Group
>WP_012881464.1 hypothetical protein [Dehalococcoides mccartyi]
MSFAAIFSIIVGALVIFQWRENLNRRAIQDPNKGYKVRWGTYELILRSAAEFATALMLILAGTGLLSEQSWGESIYLLAT
GMFIYSAVNSPGYFVQQKNWSVVAAYAIALELAILGIILFL