TCDB is operated by the Saier Lab Bioinformatics Group
>WP_022543180.1 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC [Bifidobacterium animalis]
MAEVIFDHVTRIYPGNDKPSVDDLNLDIKDGEFLVLVGPSGCGKSTTLRMLAGLEEVNKGRILIGGKDVTTMQPKDRDIA
MVFQNYALYPHMTVADNMGFALKIAGTPKDEIRKRVEKAAEILDLTEFLDRKPKALSGGQRQRVAMGRAIVREPKVFLMD
EPLSNLDAKLRVQTRTQIAALQRQLGVTTLYVTHDQTEALTMGDRIAVIKLGILQQVGAPTELYDRPANVFVAGFIGSPS
MNINTHPVVDGKAQIGADTMELPKEALDKLTPEDKNEIIVGFRPEDASLAAPDEANAFSLKVVNVEDLGSDGYIYGNIIT
DDSVAQKTTDTLMSDQNQLTTIRVNPRVLPKVGDVVKIKVNPAKMHLFSPSTELRLN