TCDB is operated by the Saier Lab Bioinformatics Group
>XP_014742247.1 PREDICTED: LOW QUALITY PROTEIN: sideroflexin-4 [Sturnus vulgaris]
MNFNFVWEMFLPAGPRHPDLHLAGPSPPSAIPRRTRGILRCPAPRLCLPGEAAGKGKAVGPGLPRGKPLERERPWGLAFP
RDAAGKGKAVGPGLPRGKPLERAPEPRRGSSVPGRSVQPRTGPAGTSGASAPXDVNLRYWRAEGQSFFQRFLLWADALDP
LLLLKSSNEIKTTRLFIQINEKTLNERVQNNQTKQAFLLSLSSVHPDTDKIIPVLFRPPAFMPITLPLVVVSSVQRQAKR
SFFWQVIASSFYFYRSSSLNPEFNFSYNLLFLQFVFHTYTTAFALINGNGTPKSEEYSLRQKQIFLGLGAISYSACVGAL
PLAFMNRYALKSPLMQLFVKKLLPAPLLGLTSAFTVAMVRSPEFDNGIEVMDRNGKVIGVSKKAGEKAVMETALSRAVLF
GTTFFLPEVLMYFVQRARLVKNPRALGPVRMFMVMSVLAGMLPVSFSMFPQCGEIKRADLEPEILSSTEETEFFYNRGI