TCDB is operated by the Saier Lab Bioinformatics Group

1.C.20 The Nisin (Nisin) Family

Many organisms synthesize proteins (or peptides) which are degraded to relatively small hydrophobic or amphipathic, bioactive peptides. These peptides exhibit antibiotic, fungicidal, virucidal, hemolytic and/or tumoricidal activities by interacting with membranes and forming transmembrane channels that allow the free flow of electrolytes, metabolites and water across the phospholipid bilayers. Most of these peptides appear to function in biological warfare. There are many designations given to these bioactive peptides. They include the magainins, cecropins, melittins, defensins, bacteriocidins, etc. The proteins in each family within this functional superfamily are homologous, but they exhibit little or no significant sequence similarity with members of the other families. Thus, each family may have evolved independently. However, certain common structural features observed between members of distinct families suggest that at least some of these families share a common ancestry. The preferential interaction of nisin with cardiolipin-enriched bilayers might explain its antitumor activity by pore-formation in mitochondrial membranes. Small natural molecules, phloretin and capsaicin potentiate the membrane activity of nisin in TOCL-containing membranes (Chernyshova et al. 2022).

The generalized transport reaction catalyzed by channel-forming amphipathic peptides is:

small solutes, electrolytes and water (in) small solutes, electrolytes and water (out).

Bacteriocins are bacterially produced peptide antibiotics with the ability to kill a limited range of bacteria, usually but not always those that are closely related to the producer bacterium. Class II bacteriocins are divided into 5 subclasses:  IIa, linear chain; IIb, two linear chains; IIc, cyclized, IId, linear but different from IIa and IIe, colicin V-like. Many of them exhibit structural features typical of members of the eukaryotic channel-forming amphipathic peptides. That is, they are usually synthesized as small precursor proteins or peptides which are processed with proteolytic elimination of their N-terminal leader sequences, and the resultant mature peptides form one, two or more putative amphipathic transmembrane α-helical spanners (TMSs). For those with two TMSs, a characteristic hinge region that separates the two putative transmembrane segments is usually observed. A similar structural arrangement occurs in the two-TMS Cecropin A proteins (TC #1.C.17).

Many bacteriocins are encoded in operons that also encode an immunity protein and an ABC transport system (TC #3.A.1) with a protease domain at the N-terminus. The ABC systems export the bacteriocins while the protease domains cleave the N-terminal leader sequence. A few bacteriocins are exported by the type II general secretory pathway rather than by ABC-type export systems. In some cases, expression of the bacteriocin-encoding operon is induced by a bacteriocin-like peptide which acts in conjunction with a two component sensor kinase-response regulator to effect induction.

Peptide bacteriocins produced by lactic acid bacteria are categorized into two different classes according to their biochemical and genetic properties (Drider et al., 2006; Nes et al., 2007). Class I peptides are the lantibiotics, which are small, posttranslationally modified peptides that contain unusual amino acids such as lanthionine (1.C.20). Class II includes unmodified bacteriocins which are subdivided into three subclasses, namely, class IIa (pediocin-like bacteriocins), class IIb (two-peptide bacteriocins), and IIc (other [i.e., non-pediocin-like], one-peptide bacteriocins).

Class I lantibiotic bacteriocins are small membrane-active channel-forming peptides of less than 5 kDa. They contain the unusual amino acids lanthionine and β-methyl lanthionine, as well as dehydrated residues. One member of family 1.C.22 (TC #1.C.22.1.2) is the thiol-activated peptide, Lactococcin B, included in Class IIc by Klaenhammer (1993).

Many bacteriocins have been identified in addition to those tabulated in the TC system, but those listed are among the best characterized, with respect to evidence for channel formation in target bacterial membranes. Class III and IV bacteriocins (Klaenhammer, 1993) are large heat-labile proteins that function by mechanisms unrelated to those of the bacteriocins listed here.

Nisin apparently forms channels in bacterial membranes using Lipid II, the prenyl chain-linked donor of the peptidoglycan building block, both as a receptor and as an intrinsic component of the pore (Breukink et al., 2003). The length of the prenyl chain of Lipid II plays an important role in maintaining pore stability. The interaction with Lipid II is required for pore formation, and the pores are stable for seconds. They have a pore diameter of 2-2.5 nm (Wiedemann et al., 2004).

Lantibiotics may kill bacteria by multiple mechanisms. These polycyclic peptides, containing unusual amino acids, have binding specificity for bacterial cells, targeting the bacterial cell wall component lipid II to form pores and thereby lyse the cells. Several members of these lipid II&150;targeted lantibiotics are too short to be able to span the lipid bilayer and cannot form pores, but they maintain their antibacterial efficacy. Hasper et al. (2006) have described an alternative mechanism by which members of the lantibiotic family kill Gram-positive bacteria. This mechanism involves removing lipid II from the cell division site (or septum), thus blocking cell wall synthesis.

Gallocin A permeabilizes bacterial membranes and kills phylogenetically closely related bacteria such as most streptococci, lactococci, and enterococci, probably through membrane pore formation. GllA1 and GllA2 secreted peptides are unusually long (42 and 60 amino acids long) and have very few charged amino acids compared to well-known class IIb bacteriocins. In silico modeling revealed that both GllA1 and GllA2 exhibit a similar hairpin-like conformation stabilized by an intramolecular disulfide bond. The GIP immunity peptide forms a hairpin-like structure similar to GllA1/GllA2. Thus, GIP blocks the formation of the GllA1/GllA2 complex by interacting with GllA1 or GllA2. Gallocin A may constitute the first class IIb bacteriocin which displays disulfide bridges important for its structure and activity and might be the founding member of a subtype of class IIb bacteriocins.  Bacteriocins are highly diverse antimicrobial peptides secreted by nearly all bacteria. In Gram-positive bacteria, they are divided into three classes based on size, amino acid composition, and structure. Class I includes small (<10 kDa), heat-stable peptides that undergo enzymatic modification during biosynthesis; class II includes small (<10 kDa), heat-stable peptides without post-translational modifications; and class III includes larger (>10 kDa), thermolabile peptides and proteins. Class II bacteriocins are further subdivided into four subtypes: class IIa consists of pediocin-like bacteriocins, class IIb consists of bacteriocins with two peptides, class IIc consists of leaderless bacteriocins, and class IId encompasses all other non-pediocin-like, single-peptide bacteriocins with a leader sequence. Previous in silico analysis revealed that gallocin A, encoded by gallo_2021 (renamed gllA2) and gallo_2020 (renamed gllA1), belongs to the class IIb bacteriocins (Pfam10439) exhibiting a characteristic double glycine leader peptide. The third gene of this operon (gallo_2019, renamed gip) was thought to encode the immunity protein (Proutière et al. 2023). The sequence of GllA1 is: kgnmgsaiggciggvllaaatgpitgggaamicvasgisayl; the sequence of GllA2 is: YSTDCLNAMITGIAGGIVAGGTGAGLVTLGVAGLPGAFVGAHIGAIGGGATCVGGMLFN; the sequence of GIP is: MIIKYSIIIFVNLVEYLLINKVFKASNDERETTGKVLLILSIVYIVVDILFNASK. The GllA2 protein ismost similar to 1.C.30.1.3 (e-12), but GllA1 shows greatest similarity with the same TC protein but with a much lower score.  GIP does not show appreciable similarity with any thing else in TC type 1.C. 

 

 

References associated with 1.C.20 family:

Allison, G.E., C. Fremaux, and T.R. Klaenhammer. (1994). Expansion of bacteriocin activity and host range upon complementation of two peptides encoded within the lactacin F operon. J. Bacteriol. 176: 2235-2241. 8157592
Breukink, E., H.E. van Heusden, P.J. Vollmerhaus, E. Swiezewska, L. Brunner, S. Walker, A.J.R. Heck, and B. de Kruijff. (2003). Lipid II is an intrinsic component of the pore induced by nisin in bacterial membranes. J. Biol. Chem. 278: 19898-19903. 12663672
Brötz, H., M. Josten, I. Wiedemann, U. Schneider, F. Götz, G. Bierbaum, and H.G. Sahl. (1998). Role of lipid-bound peptidoglycan precursors in the formation of pores by nisin, epidermin and other lantibiotics. Mol. Microbiol. 30: 317-327. 9791177
Chernyshova, D.N., A.A. Tyulin, O.S. Ostroumova, and S.S. Efimova. (2022). Discovery of the Potentiator of the Pore-Forming Ability of Lantibiotic Nisin: Perspectives for Anticancer Therapy. Membranes (Basel) 12:. 36422158
Diep, D.B., L.S. Håvarstein, and I.F. Nes. (1995). A bacteriocin-like peptide induces bacteriocin synthesis in Lactobacillus plantarum C11. Mol. Microbiol. 18: 631-639. 8817486
Drider D., G. Fimland, Y. Héchard, L.M. McMullen, H. Prévost. (2006). The continuing story of class IIa bacteriocins. Microbiol Mol Biol Rev. 70: 564-582. 16760314
Driessen, A.J., H.W. van den Hooven, W. Kuiper, M. van de Kamp, H.G. Sahl, R.N. Konings, and W.N. Konings. (1995). Mechanistic studies of lantibiotic-induced permeabilization of phospholipid vesicles. Biochemistry 34: 1606-1614. 7849020
Götz, F., S. Perconti, P. Popella, R. Werner, and M. Schlag. (2014). Epidermin and gallidermin: Staphylococcal lantibiotics. Int. J. Med. Microbiol. 304: 63-71. 24119540
Guo, L., O.P. Kuipers, and J. Broos. (2024). An Engineered Nisin Analogue with a Hydrophobic Moiety Attached at Position 17 Selectively Inhibits Strains. ACS Chem Biol 19: 2023-2031. 39254256
Hasper, H.E., N.E. Kramer, J.L. Smith, J.D. Hillman, C. Zachariah, O.P. Kuipers, B. de Kruijff, and E. Breukink. (2006). An alternative bactericidal mechanism of action for lantibiotic peptides that target lipid II. Science 313: 1636-1637. 16973881
Kingkaew, E., W. Woraprayote, J. Sitdhipol, R.K. Vilaichone, W. Visessanguan, and S. Tanasupawat. (2025). Genomic Assessment, Metabolic Profile Mapping, and Anti-Helicobacter pylori Activity of Lactococcus lactis SK2-659 from Thai Fermented Green Mustard (Pak-kad-dong). Probiotics Antimicrob Proteins. [Epub: Ahead of Print] 40146366
Klaenhammer, T.R. (1993). Genetics of bacteriocins produced by lactic acid bacteria. FEMS Microbiol. Rev. 12: 39-85. 8398217
McAuliffe, O., R.P. Ross, and C. Hill. (2001). Lantibiotics: structure, biosynthesis and mode of action. FEMS Microbiol. Rev. 25: 285-308. 11348686
Moll, G.N., W.N. Konings, and A.J.M. Driessen. (1999). Bacteriocins: mechanism of membrane insertion and pore formation. Antonie van Leeuwenhoek 76: 185-198. 10532378
Nes I.F., D.B. Diep, H. Holo H. (2007). Bacteriocin diversity in Streptococcus and Enterococcus. J Bacteriol. 189: 1189-1198. 17098898
Nes, I.F., D.B. Diep, L.S. Håvarstein, M.B. Brurberg, V. Eijsink, and H. Holo. (1996). Biosynthesis of bacteriocins in lactic acid bacteria. Antonie van Leeuwenhoek 70: 113-128. 8879403
Pokhrel, R., N. Bhattarai, P. Baral, B.S. Gerstman, J.H. Park, M. Handfield, and P.P. Chapagain. (2019). Molecular mechanisms of pore formation and membrane disruption by the antimicrobial lantibiotic peptide Mutacin 1140. Phys Chem Chem Phys. [Epub: Ahead of Print] 31147666
Pokhrel, R., N. Bhattarai, P. Baral, B.S. Gerstman, J.H. Park, M. Handfield, and P.P. Chapagain. (2021). Lipid II Binding and Transmembrane Properties of Various Antimicrobial Lanthipeptides. J Chem Theory Comput. [Epub: Ahead of Print] 34874159
Proutière, A., L. du Merle, M. Garcia-Lopez, C. Léger, A. Voegele, A. Chenal, A. Harrington, Y. Tal-Gan, T. Cokelaer, P. Trieu-Cuot, and S. Dramsi. (2023). Gallocin A, an Atypical Two-Peptide Bacteriocin with Intramolecular Disulfide Bonds Required for Activity. Microbiol Spectr 11: e0508522. [Epub: Ahead of Print] 36951576
Sahl, H.-G. and G. Bierbaum. (1998). Lantibiotics: biosynthesis and biological activities of uniquely modified peptides from Gram-positive bacteria. Annu. Rev. Microbiol. 52: 41-79. 9891793
Smith, L., H. Hasper, E. Breukink, J. Novak, J. Cerkasov, J.D. Hillman, S. Wilson-Stanford, and R.S. Orugunty. (2008). Elucidation of the antimicrobial mechanism of mutacin 1140. Biochem. 47: 3308-3314. 18266322
Sun, Z., P. Li, F. Liu, H. Bian, D. Wang, X. Wang, Y. Zou, C. Sun, and W. Xu. (2017). Synergistic antibacterial mechanism of the Lactobacillus crispatus surface layer protein and nisin on Staphylococcus saprophyticus. Sci Rep 7: 265. 28325944
Suzuki, Y., M. Kawada-Matsuo, M.N.-.T. Le, S. Eng, J. Hisatsune, M. Sugai, T. Sakaguchi, and H. Komatsuzawa. (2024). The two-component regulatory systems GraRS and SrrAB mediate susceptibility to Pep5 produced by clinical isolate of. Appl. Environ. Microbiol. 90: e0030024. 38832774
Venema, K., G. Venema, and J. Kok. (1995). Lactococcal bacteriocins: mode of action and immunity. Trends Microbiol. 3: 299-304. 8528613
Wiedemann, I., R. Benz, and H.-G. Sahl. (2004). Lipid II-mediated pore formation by the peptide antibiotic nisin: a black lipid membrane study. J. Bacteriol. 186: 3259-3261. 15126490