TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A0M0P7|A0M0P7_GRAFK Membrane protein containing the N-terminal domain of lipid-A-disaccharide synthase OS=Gramella forsetii (strain KT0803) GN=GFO_1218 PE=4 SV=1
MSSWLIYTIGFSAQLLFSGRSILQWIISEKQKKVLTPVLFWQLSLIASFLLFMYGYLRNDFAIMLGQILTYFIYIRNMHL
QNQWLKFPKMLRWFLYIFPFIILYIGYNNHVYDRAKLFQNDNIPLWLLLLGIIAQVIFTLRFVYQWFYSEKRKVSSLPLG
FWFLSLFGSLMILIYAIFRKDPVLLLGHSLGIFLYVRNILILKTESKIL