TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A1R937|A1R937_PAEAT Putative ABC transporter, ATP binding protein OS=Paenarthrobacter aurescens (strain TC1) OX=290340 GN=AAur_3047 PE=4 SV=1
MTQAIVVEGLRKKFGPREVLHGLDFAVESGTVFGVIGPNGAGKTTTMRCLLDIIRPSAGSISVLGQDPRQAGTALRRRIG
YLPGELHLENRTTGRRVLEHFAAISGPVDPQHVKQLAERLDLDLDRQTRKLSKGNKQKLGLLQAFMHKPELLVLDEPTSG
LDPLVQQVFHAMVREAVDDGATVFLSSHVLSEVQQAADAVAILRDGEIVTVSTVEELRTAAVRQLRFNSTGTEPHDVGAL
LARVPGVANVAVRELKADGHTAGTVEAVATLSGHVQPLVQELAKLNLTDLVLEEPDLEEAVLTLYAGQPPRLGQSTENGQ
SAGNGRTPGRHTEGAHRA