TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A2ENV1|A2ENV1_TRIVA Uncharacterized protein OS=Trichomonas vaginalis OX=5722 GN=TVAG_216170 PE=4 SV=1
MNPDSYKKIGQKLTKLEYQSGFAVTLKYKKTKTTASCDEEFATPALTSEFKVKKVGKIQCGFKDGKSQLIFSPKLEKLDA
KLDFNAIDNSFLFEYAKKVKPINSLVTIKYDSAKNEPSVLIQPKFKLNKINFDANLLFKKPVENCPPVIFQAHAAYKKLF
LCSCFNEEEKEYRAAAFAKLFKGIHAGALLHFDPLAEKQMKAVDVFAKYSFKKGKIAAITTLLGEKPVVKVNAKAKVGKK
AKIGINTVYGETITGDFGVKADLKKFKLNLIVNAKKESDEISEGLIAQTAFKVKRVGKAKVGVAIPSIQEAQKAHLFVNL
KIKD