TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A2RKA7|A2RKA7_LACLM Purine/cytidine ABC transporter ATP-binding protein OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=nupA PE=4 SV=1
MANETVIQMIDVTKRFGDFVANDKVNLELKKGEIHALLGENGAGKSTLMNILSGLLEPSEGEVHVKGKLENIDSPSKAAN
LGIGMVHQHFMLVDAFTVTENIILGNEVTKGINLDLKTAKKKILELSERYGLSVEPDALIRDISVGQQQRVEILKTLYRG
ADILIFDEPTAVLTPAEITELMQIMKNLIKEGKSIILITHKLDEIRAVADRITVIRRGKSIDTVELGDKTNQELAELMVG
RSVSFITEKAAAQPKDVVLEIKDLNIKESRGSLKVKGLSLDVRAGEIVGVAGIDGNGQTELVKAITGLTKVDSGSIKLHN
KDITNQRPRKITEQSVGHVPEDRHRDGLVLEMTVAENIALQTYYKPPMSKYGFLDYNKINSHARELMEEFDVRGAGEWVS
ASSLSGGNQQKAIIAREIDRNPDLLIVSQPTRGLDVGAIEYIHKRLIQARDEGKAVLVISFELDEILNVSDRIAVIHDGQ
IQGIVSPETTTKQELGILMVGGNINE