TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A2SSY9|A2SSY9_METLZ Putative uncharacterized protein OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=Mlab_1276 PE=4 SV=1
MDAKQKKFLWISIGLSLAVLLIVILLTFNEETIVAIQQLNPLYLLLAFMVHMLAMGFWATRIVVMCRSLGYKVPFFHSLN
MVCAGQLIAAITPSQIGGEPVRIHELYKANVPVADATAVVLIERLLEAVLMVLGVMFAMGMFSFVYNNGEIPEGLIIAAW
CGTAFFTGLLIILVAIMRKPELIKKLALKIGGLFMKKMNPEKVEKITGQILDGVDQFYNTFRLFAGKAKWGLFIGFILTF
CLWACEYSVASIILMGLGYPPNVLLSIIFQLIIAVIMMLPLTPGAAGIAELAYAGFYSLIIPSSVVGLFVVLLRMILYYS
NILIGFIASFLIVKREAANKKVISDDA