TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A3QJX1|A3QJX1_DANRE Potassium channel protein TREK2A OS=Danio rerio GN=kcnk10a PE=2 SV=2
MKFPTENPRKPGNWNPPPVPVQTNLVPPKKVQPGMLQSSLVQASVATMQNPMGCSLPRLSVSRPASMVASMEAVADGSAL
LTVMKWKTVLAVFVVVVAYLVAGGLVFRALEQHFERYQKDSITLKKAAFLLKHPCVTPDELEELIKHSVDAVNAGVSPIG
DTSYNSSHWDLGSSFFFAGTVITTIGYGNIAPSTEGGKIFCILYAIFGIPLFGFLLAGVGDQLGTIFGKSIAKVEKMFRR
KHNQISQTKIRVASTLLFILAGCILFVTIPAIIFKHIEGWTGLEAIYFVVITLTTVGIGDYVAGGNRRIEYRKWYRPLVW
FWILVGLAYFAAVLSMIGDWLRVLSKKTKMEVGEIKAHAAEWKANVRAELRETRRRLSVEVHDKLQRAATIRSMERRQLG
FDQRAHSLDMLSPERRAAFNSLDATNFKTSSQESIDTKLNNLRLRVEQNEHRRSDPSQAYSEDNIFNRLGSVTKLAKRNK
NRDLKKNILDDGRKALDSFSCDTPPMDEEKKEAEDEELEKEVNISLTNLPLFVESPNKQNGFVPLPPQTKEEETETKLED
KEFRLQVDP